USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off
Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off

Gucci X ADIDAS Textured Dollar Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag Hibiscus Red Off

$350.00 inc. tax

This is an authentic GUCCI X ADIDAS Textured Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag in Hibiscus Red and Off White. This stylish shoulder bag was designed in a collaboration between Gucci and Adidas and is crafted in beautiful leather in red with the Adidas logo in white. The bag features an adjustable leather shoulder strap, red and green web canvas strap and gold horsebit detail. The top flap opens to a beige fabric interior.

This is an authentic GUCCI X ADIDAS Textured Calfskin Web Trefoil Mini Horsebit 1955 Shoulder Bag in Hibiscus Red and Off White. This stylish shoulder bag was designed in a collaboration between Gucci and Adidas and is crafted in beautiful leather in red with the Adidas logo in white. The bag features an adjustable leather shoulder strap, red and green web canvas strap and gold horsebit detail. The top flap opens to a beige fabric interior.

Product Code: tEVlL3W
Brand: Gucci
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Related Products
Burberry Yellow Vintage..
Burberry Yellow Vintage..
$310.00
Louis Vuitton Carmel Ho..
Louis Vuitton Carmel Ho..
$350.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract